Lineage for d1w2kl1 (1w2k L:46-82)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 747016Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 747704Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 747705Family g.3.11.1: EGF-type module [57197] (22 proteins)
  6. 747785Protein Factor IX (IXa) [57198] (2 species)
  7. 747791Species Pig (Sus scrofa) [TaxId:9823] [57200] (16 PDB entries)
  8. 747816Domain d1w2kl1: 1w2k L:46-82 [120585]
    Other proteins in same PDB: d1w2kh1, d1w2kl3, d1w2kt1, d1w2kt2
    automatically matched to d1pfxl1
    complexed with 380, bgc, ca, cac, fuc

Details for d1w2kl1

PDB Entry: 1w2k (more details), 3 Å

PDB Description: tf7a_4380 complex
PDB Compounds: (L:) blood coagulation factor viia

SCOP Domain Sequences for d1w2kl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w2kl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]}
dgdqcasspcqnggsckdqlqsyicfclpafegrnce

SCOP Domain Coordinates for d1w2kl1:

Click to download the PDB-style file with coordinates for d1w2kl1.
(The format of our PDB-style files is described here.)

Timeline for d1w2kl1: