SCOP 1.73: Domain d1w24a1: 1w24 A:1-181

Lineage for d1w24a1 (1w24 A:1-181)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (10 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.7: YfcE-like [111233] (3 proteins)

6. Protein Vacuolar protein sorting 29, VPS29 [143935] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [143936] (3 PDB entries)

8. Domain d1w24a1: 1w24 A:1-181 [120579]
   automatically matched to 1Z2W A:1-182

Details for d1w24a1

PDB Entry: 1w24, 2.1 Å

PDB Description: crystal structure of human vps29

PDB Compounds: (A:) vacuolar protein sorting protein 29

SCOP Domain Sequences for d1w24a1:

Sequence, based on SEQRES records:

>d1w24a1 d.159.1.7 (A:1-181) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]}
mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
k

Sequence, based on observed residues (ATOM records):

>d1w24a1 d.159.1.7 (A:1-181) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]}
mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
gdfdenlnypeqkvvtvgqfkiglihghqvipdmaslallqrqfdvdilisghthkfeaf
ehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieykk

Timeline for d1w24a1:

• d1w24a1 is new in SCOP 1.73
  
• d1w24a1 appears in SCOP 1.75
  
• d1w24a1 appears in the current release, SCOPe 2.08, called d1w24a_