SCOPe 2.02: Domain d1w0va2: 1w0v A:1-181

Lineage for d1w0va2 (1w0v A:1-181)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)

7. Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (12 PDB entries)
   Uniprot P30481 25-300

8. Domain d1w0va2: 1w0v A:1-181 [120561]
   Other proteins in same PDB: d1w0va1, d1w0vb_
   automatically matched to d1m6oa2
   complexed with gol

Details for d1w0va2

PDB Entry: 1w0v, 2.27 Å

PDB Description: crystal structure of hla-b*2705 complexed with the self-peptide tis from egf-response factor 1

PDB Compounds: (A:) hla class I histocompatibility antigen

SCOPe Domain Sequences for d1w0va2:

Sequence; same for both SEQRES and ATOM records:

>d1w0va2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqdaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

Timeline for d1w0va2:

• d1w0va2 first appeared in SCOP 1.73
  
• d1w0va2 appears in SCOPe 2.01
  
• d1w0va2 appears in SCOPe 2.03
  
• d1w0va2 appears in the current release, SCOPe 2.08