Class g: Small proteins [56992] (90 folds) |
Fold g.42: Ribosomal protein L36 [57839] (1 superfamily) zinc-bound beta-ribbon motif |
Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family) |
Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein) |
Protein Ribosomal protein L36 [57842] (3 species) |
Species Thermus thermophilus [TaxId:274] [57843] (6 PDB entries) |
Domain d1vsab1: 1vsa b:2-36 [120517] Other proteins in same PDB: d1vsaa1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1 automatically matched to d1dfea_ |
PDB Entry: 1vsa (more details), 3.71 Å
SCOP Domain Sequences for d1vsab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vsab1 g.42.1.1 (b:2-36) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]} kvrasvkricdkckvirrhgrvyvicenpkhkqrq
Timeline for d1vsab1: