SCOP 1.75: Domain d1vsab1: 1vsa b:2-36

Lineage for d1vsab1 (1vsa b:2-36)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.42: Ribosomal protein L36 [57839] (1 superfamily)
   zinc-bound beta-ribbon motif

4. Superfamily g.42.1: Ribosomal protein L36 [57840] (1 family)

5. Family g.42.1.1: Ribosomal protein L36 [57841] (1 protein)

6. Protein Ribosomal protein L36 [57842] (3 species)

7. Species Thermus thermophilus [TaxId:274] [57843] (6 PDB entries)

8. Domain d1vsab1: 1vsa b:2-36 [120517]
   Other proteins in same PDB: d1vsaa1, d1vsac1, d1vsaf1, d1vsaf2, d1vsah1, d1vsai1, d1vsaj1, d1vsal1, d1vsam1, d1vsao1, d1vsap1, d1vsaq1, d1vsar1, d1vsas1, d1vsat1, d1vsau1, d1vsaw1, d1vsax1, d1vsaz1
   automatically matched to d1dfea_

Details for d1vsab1

PDB Entry: 1vsa, 3.71 Å

PDB Description: Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements. This file, 1VSA, contains the 50S ribosome subunit. 30S ribosome subunit is in the file 2OW8

PDB Compounds: (b:) 50S ribosomal protein L36

SCOP Domain Sequences for d1vsab1:

Sequence; same for both SEQRES and ATOM records:

>d1vsab1 g.42.1.1 (b:2-36) Ribosomal protein L36 {Thermus thermophilus [TaxId: 274]}
kvrasvkricdkckvirrhgrvyvicenpkhkqrq

Timeline for d1vsab1:

• d1vsab1 first appeared in SCOP 1.73
  
• d1vsab1 appears in SCOPe 2.01
  
• d1vsab1 appears in the current release, SCOPe 2.08