SCOP 1.73: Domain d1vrcb1: 1vrc B:2-130

Lineage for d1vrcb1 (1vrc B:2-130)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.54: IIA domain of mannose transporter, IIA-Man [53061] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest

4. Superfamily c.54.1: IIA domain of mannose transporter, IIA-Man [53062] (1 family)
   active dimer is formed by strand 5 swapping

5. Family c.54.1.1: IIA domain of mannose transporter, IIA-Man [53063] (1 protein)

6. Protein IIA domain of mannose transporter, IIA-Man [53064] (1 species)

7. Species Escherichia coli [TaxId:562] [53065] (2 PDB entries)

8. Domain d1vrcb1: 1vrc B:2-130 [120455]
   Other proteins in same PDB: d1vrcc1, d1vrcd1
   automatically matched to d1pdo__
   complexed with po3

Details for d1vrcb1

PDB Entry: 1vrc

PDB Description: complex of enzyme iiamannose and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure

PDB Compounds: (B:) PTS system, mannose-specific IIAB component

SCOP Domain Sequences for d1vrcb1:

Sequence; same for both SEQRES and ATOM records:

>d1vrcb1 c.54.1.1 (B:2-130) IIA domain of mannose transporter, IIA-Man {Escherichia coli [TaxId: 562]}
tiaivigthgwaaeqllktaemllgeqenvgwidfvpgenaetliekynaqlakldttkg
vlflvdtwggspfnaasrivvdkehyeviagvnipmlvetlmardddpsfdelvalavet
gregvkalk

Timeline for d1vrcb1:

• d1vrcb1 is new in SCOP 1.73
  
• d1vrcb1 appears in SCOP 1.75
  
• d1vrcb1 appears in the current release, SCOPe 2.08, called d1vrcb_