Lineage for d1vqyb1 (1vqy B:1-104)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 723747Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 723911Family d.58.4.13: NIPSNAP [117943] (2 proteins)
    Pfam PF07978
  6. 723927Protein Hypothetical protein Atu5224 [143263] (1 species)
  7. 723928Species Agrobacterium tumefaciens [TaxId:358] [143264] (1 PDB entry)
  8. 723930Domain d1vqyb1: 1vqy B:1-104 [120419]
    automatically matched to 1VQY A:1-104
    complexed with po4

Details for d1vqyb1

PDB Entry: 1vqy (more details), 2.4 Å

PDB Description: crystal structure of a nipsnap family protein (atu5224) from agrobacterium tumefaciens str. c58 at 2.40 a resolution
PDB Compounds: (B:) hypothetical protein AGR_pAT_315

SCOP Domain Sequences for d1vqyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqyb1 d.58.4.13 (B:1-104) Hypothetical protein Atu5224 {Agrobacterium tumefaciens [TaxId: 358]}
miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl
ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr

SCOP Domain Coordinates for d1vqyb1:

Click to download the PDB-style file with coordinates for d1vqyb1.
(The format of our PDB-style files is described here.)

Timeline for d1vqyb1: