Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (17 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.13: NIPSNAP [117943] (2 proteins) Pfam PF07978 |
Protein Hypothetical protein Atu5224 [143263] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [143264] (1 PDB entry) |
Domain d1vqyb1: 1vqy B:1-104 [120419] automatically matched to 1VQY A:1-104 complexed with po4 |
PDB Entry: 1vqy (more details), 2.4 Å
SCOP Domain Sequences for d1vqyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqyb1 d.58.4.13 (B:1-104) Hypothetical protein Atu5224 {Agrobacterium tumefaciens [TaxId: 358]} miveeriyrirggkmqeylklvreegiaiqapilgnligyfvtdigplsqvihmwgyasl ddraerrgklaedqrwqafiprlsvliessenrillptdfsplr
Timeline for d1vqyb1: