SCOP 1.73: Domain d1vqpr1: 1vqp R:1-150

Lineage for d1vqpr1 (1vqp R:1-150)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
   beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation

4. Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family)
   some topological similarity to prokaryotic ribosomal protein L17

5. Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)

6. Protein Ribosomal protein L22 [54845] (2 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54847] (39 PDB entries)

8. Domain d1vqpr1: 1vqp R:1-150 [120408]
   Other proteins in same PDB: d1vqp11, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqph1, d1vqpi1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
   automatically matched to d1ffko_
   complexed with 1ma, cd, cl, dcz, hfa, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqpr1

PDB Entry: 1vqp, 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (R:) 50S ribosomal protein L22P

SCOP Domain Sequences for d1vqpr1:

Sequence; same for both SEQRES and ATOM records:

>d1vqpr1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Archaeon Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

Timeline for d1vqpr1:

• d1vqpr1 is new in SCOP 1.73
  
• d1vqpr1 appears in SCOP 1.75
  
• d1vqpr1 appears in the current release, SCOPe 2.08