Lineage for d1vqpi1 (1vqp I:71-140)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2308802Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 2308803Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 2308804Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 2308852Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
    Uniprot P14122 67-136
  8. 2308855Domain d1vqpi1: 1vqp I:71-140 [120399]
    Other proteins in same PDB: d1vqp11, d1vqp21, d1vqp31, d1vqpa1, d1vqpa2, d1vqpb1, d1vqpc1, d1vqpd1, d1vqpe1, d1vqpe2, d1vqpf1, d1vqpg1, d1vqph1, d1vqpj1, d1vqpk1, d1vqpl1, d1vqpm1, d1vqpn1, d1vqpo1, d1vqpp1, d1vqpq1, d1vqpr1, d1vqps1, d1vqpt1, d1vqpu1, d1vqpv1, d1vqpw1, d1vqpx1, d1vqpy1, d1vqpz1
    automatically matched to d1s72i_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqpi1

PDB Entry: 1vqp (more details), 2.25 Å

PDB Description: The structure of the transition state analogue "RAP" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d1vqpi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqpi1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tctslgvtie

SCOPe Domain Coordinates for d1vqpi1:

Click to download the PDB-style file with coordinates for d1vqpi1.
(The format of our PDB-style files is described here.)

Timeline for d1vqpi1: