| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily) core: three turns of irregular (beta-beta-alpha)n superhelix |
Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) ![]() |
| Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins) |
| Protein Ribosomal protein L18e [52084] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries) |
| Domain d1vqoo1: 1vqo O:1-115 [120376] Other proteins in same PDB: d1vqo11, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 automatically matched to d1ffkl_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3 |
PDB Entry: 1vqo (more details), 2.2 Å
SCOP Domain Sequences for d1vqoo1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqoo1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Archaeon Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
Timeline for d1vqoo1:
View in 3DDomains from other chains: (mouse over for more information) d1vqo11, d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 |