![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (6 families) ![]() |
![]() | Family b.43.3.2: Ribosomal protein L3 [50461] (1 protein) |
![]() | Protein Ribosomal protein L3 [50462] (4 species) superfamily fold is elaborated with additional structures |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [50463] (58 PDB entries) Uniprot P20279 |
![]() | Domain d1vqob1: 1vqo B:1-337 [120363] Other proteins in same PDB: d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 automatically matched to d1jj2b_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3 |
PDB Entry: 1vqo (more details), 2.2 Å
SCOP Domain Sequences for d1vqob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqob1 b.43.3.2 (B:1-337) Ribosomal protein L3 {Archaeon Haloarcula marismortui [TaxId: 2238]} pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg
Timeline for d1vqob1:
![]() Domains from other chains: (mouse over for more information) d1vqo11, d1vqo21, d1vqo31, d1vqoa1, d1vqoa2, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqog1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 |