![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (16 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) ![]() |
![]() | Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein) |
![]() | Protein Ribosomal protein L37e [57834] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries) |
![]() | Domain d1vqo11: 1vqo 1:1-56 [120359] Other proteins in same PDB: d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 automatically matched to d1ffkx_ complexed with 1ma, cd, cl, k, mg, na, omg, omu, ppu, psu, sr, ur3 |
PDB Entry: 1vqo (more details), 2.2 Å
SCOP Domain Sequences for d1vqo11:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqo11 g.41.8.2 (1:1-56) Ribosomal protein L37e {Archaeon Haloarcula marismortui [TaxId: 2238]} tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
Timeline for d1vqo11:
![]() Domains from other chains: (mouse over for more information) d1vqo31, d1vqoa1, d1vqoa2, d1vqob1, d1vqoc1, d1vqod1, d1vqoe1, d1vqoe2, d1vqof1, d1vqoh1, d1vqoi1, d1vqoj1, d1vqok1, d1vqol1, d1vqom1, d1vqon1, d1vqoo1, d1vqop1, d1vqoq1, d1vqor1, d1vqos1, d1vqot1, d1vqou1, d1vqov1, d1vqow1, d1vqox1, d1vqoy1, d1vqoz1 |