Lineage for d1vqnj1 (1vqn J:4-145)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855226Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 2855227Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 2855228Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 2855229Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 2855267Species Haloarcula marismortui [TaxId:2238] [52164] (40 PDB entries)
    Uniprot P29198
  8. 2855275Domain d1vqnj1: 1vqn J:4-145 [120342]
    Other proteins in same PDB: d1vqn11, d1vqn21, d1vqn31, d1vqna1, d1vqna2, d1vqnb1, d1vqnc1, d1vqnd1, d1vqne1, d1vqne2, d1vqnf1, d1vqng1, d1vqnh1, d1vqni1, d1vqnk1, d1vqnl1, d1vqnm1, d1vqnn1, d1vqno1, d1vqnp1, d1vqnq1, d1vqnr1, d1vqns1, d1vqnt1, d1vqnu1, d1vqnv1, d1vqnw1, d1vqnx1, d1vqny1, d1vqnz1
    automatically matched to d1ffkg_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr

Details for d1vqnj1

PDB Entry: 1vqn (more details), 2.4 Å

PDB Description: the structure of cc-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (J:) 50S ribosomal protein L13P

SCOPe Domain Sequences for d1vqnj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqnj1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOPe Domain Coordinates for d1vqnj1:

Click to download the PDB-style file with coordinates for d1vqnj1.
(The format of our PDB-style files is described here.)

Timeline for d1vqnj1: