SCOP 1.73: Domain d1vqmv1: 1vqm V:1-65

Lineage for d1vqmv1 (1vqm V:1-65)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.2: Long alpha-hairpin [46556] (19 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (4 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)

8. Domain d1vqmv1: 1vqm V:1-65 [120325]
   Other proteins in same PDB: d1vqm11, d1vqm31, d1vqma1, d1vqma2, d1vqmb1, d1vqmc1, d1vqmd1, d1vqme1, d1vqme2, d1vqmf1, d1vqmh1, d1vqmi1, d1vqmj1, d1vqmk1, d1vqml1, d1vqmm1, d1vqmn1, d1vqmo1, d1vqmp1, d1vqmq1, d1vqmr1, d1vqms1, d1vqmt1, d1vqmu1, d1vqmw1, d1vqmx1, d1vqmy1, d1vqmz1
   automatically matched to d1ffks_
   complexed with 1ma, cd, cl, k, mg, na, omg, omu, po2, ppu, psu, sr, ur3

Details for d1vqmv1

PDB Entry: 1vqm, 2.3 Å

PDB Description: the structure of the transition state analogue "dan" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (V:) 50S ribosomal protein L29P

SCOP Domain Sequences for d1vqmv1:

Sequence; same for both SEQRES and ATOM records:

>d1vqmv1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d1vqmv1:

• d1vqmv1 is new in SCOP 1.73
  
• d1vqmv1 appears in SCOP 1.75
  
• d1vqmv1 appears in the current release, SCOPe 2.08