SCOPe 2.01: Domain d1vqlv1: 1vql V:1-65

Lineage for d1vqlv1 (1vql V:1-65)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family)

5. Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)

6. Protein Ribosomal protein L29 (L29p) [46563] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)
   Uniprot P10971

8. Domain d1vqlv1: 1vql V:1-65 [120296]
   Other proteins in same PDB: d1vql11, d1vql21, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlf1, d1vqlg1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1
   automatically matched to d1ffks_
   protein/RNA complex; complexed with cd, cl, k, mg, na, sr, tse

Details for d1vqlv1

PDB Entry: 1vql, 2.3 Å

PDB Description: the structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1vqlv1:

Sequence; same for both SEQRES and ATOM records:

>d1vqlv1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Timeline for d1vqlv1:

• d1vqlv1 first appeared in SCOP 1.73
  
• d1vqlv1 appears in SCOP 1.75
  
• d1vqlv1 appears in SCOPe 2.02
  
• d1vqlv1 appears in the current release, SCOPe 2.08