Lineage for d1vqlf1 (1vql F:1-119)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914576Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 1914577Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 1914594Protein Ribosomal protein L7ae [55319] (7 species)
  7. 1914602Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 1914610Domain d1vqlf1: 1vql F:1-119 [120281]
    Other proteins in same PDB: d1vql11, d1vql21, d1vql31, d1vqla1, d1vqla2, d1vqlb1, d1vqlc1, d1vqld1, d1vqle1, d1vqle2, d1vqlg1, d1vqlh1, d1vqli1, d1vqlj1, d1vqlk1, d1vqll1, d1vqlm1, d1vqln1, d1vqlo1, d1vqlp1, d1vqlq1, d1vqlr1, d1vqls1, d1vqlt1, d1vqlu1, d1vqlv1, d1vqlw1, d1vqlx1, d1vqly1, d1vqlz1
    automatically matched to d1s72f_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sr, tse

Details for d1vqlf1

PDB Entry: 1vql (more details), 2.3 Å

PDB Description: the structure of the transition state analogue "dcsn" bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d1vqlf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqlf1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOPe Domain Coordinates for d1vqlf1:

Click to download the PDB-style file with coordinates for d1vqlf1.
(The format of our PDB-style files is described here.)

Timeline for d1vqlf1: