| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.9: Barstar-like [52037] (2 superfamilies) 2 layers, a/b; parallel beta-sheet of 3 strands, order 123 |
Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) ![]() |
| Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein) contains irregular N-terminal extension to the common fold |
| Protein Ribosomal protein L32e [52044] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries) Uniprot P12736 |
| Domain d1vqky1: 1vqk Y:95-236 [120270] Other proteins in same PDB: d1vqk11, d1vqk21, d1vqk31, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkg1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqkz1 automatically matched to d1jj2x_ complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sr, ur3 |
PDB Entry: 1vqk (more details), 2.3 Å
SCOP Domain Sequences for d1vqky1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vqky1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Archaeon Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev
Timeline for d1vqky1:
View in 3DDomains from other chains: (mouse over for more information) d1vqk11, d1vqk21, d1vqk31, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkg1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqkz1 |