Lineage for d1vqku1 (1vqk U:4-56)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750235Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 750236Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (15 families) (S)
  5. 750455Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
  6. 750456Protein Ribosomal protein L24e [57750] (1 species)
  7. 750457Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
  8. 750463Domain d1vqku1: 1vqk U:4-56 [120266]
    Other proteins in same PDB: d1vqk11, d1vqk31, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqke1, d1vqke2, d1vqkf1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqkr1, d1vqks1, d1vqkt1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1, d1vqkz1
    automatically matched to d1ffkr_
    complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sr, ur3

Details for d1vqku1

PDB Entry: 1vqk (more details), 2.3 Å

PDB Description: the structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
PDB Compounds: (U:) 50S ribosomal protein L24e

SCOP Domain Sequences for d1vqku1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqku1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

SCOP Domain Coordinates for d1vqku1:

Click to download the PDB-style file with coordinates for d1vqku1.
(The format of our PDB-style files is described here.)

Timeline for d1vqku1: