Lineage for d1vqke1 (1vqk E:1-79)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734251Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
    consists of two beta-sheets and one alpha-helix packed around single core
  4. 734252Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family) (S)
  5. 734253Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)
  6. 734254Protein Ribosomal protein L6 [56055] (2 species)
    duplication: consists of two domains of this fold
  7. 734255Species Archaeon Haloarcula marismortui [TaxId:2238] [56057] (40 PDB entries)
  8. 734266Domain d1vqke1: 1vqk E:1-79 [120250]
    Other proteins in same PDB: d1vqk11, d1vqk31, d1vqka1, d1vqka2, d1vqkb1, d1vqkc1, d1vqkd1, d1vqkf1, d1vqkh1, d1vqki1, d1vqkj1, d1vqkk1, d1vqkl1, d1vqkm1, d1vqkn1, d1vqko1, d1vqkp1, d1vqkq1, d1vqkr1, d1vqks1, d1vqkt1, d1vqku1, d1vqkv1, d1vqkw1, d1vqkx1, d1vqky1, d1vqkz1
    automatically matched to d1ffk11
    complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sr, ur3

Details for d1vqke1

PDB Entry: 1vqk (more details), 2.3 Å

PDB Description: the structure of ccda-phe-cap-bio bound to the a site of the ribosomal subunit of haloarcula marismortui
PDB Compounds: (E:) 50S ribosomal protein L6P

SCOP Domain Sequences for d1vqke1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vqke1 d.141.1.1 (E:1-79) Ribosomal protein L6 {Archaeon Haloarcula marismortui [TaxId: 2238]}
prveleipedvdaeqdhlditvegdngsvtrrlwypdidvsvdgdtvviesdednaktms
tigtfqshienmfhgvteg

SCOP Domain Coordinates for d1vqke1:

Click to download the PDB-style file with coordinates for d1vqke1.
(The format of our PDB-style files is described here.)

Timeline for d1vqke1: