Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily) core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold |
Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) |
Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins) |
Protein Archaeal L30 (L30a) [55133] (1 species) long-chain member of the family; contains additional C-terminal (sub)domain |
Species Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries) Uniprot P14121 |
Domain d1vq9w1: 1vq9 W:1-154 [120239] Other proteins in same PDB: d1vq911, d1vq921, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9g1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9x1, d1vq9y1, d1vq9z1 automatically matched to d1ffkt_ protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr |
PDB Entry: 1vq9 (more details), 2.4 Å
SCOPe Domain Sequences for d1vq9w1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq9w1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Haloarcula marismortui [TaxId: 2238]} mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp prgghdgvkhpvkeggqlgkhdtegiddlleamr
Timeline for d1vq9w1:
View in 3D Domains from other chains: (mouse over for more information) d1vq911, d1vq921, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9g1, d1vq9h1, d1vq9i1, d1vq9j1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9x1, d1vq9y1, d1vq9z1 |