| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.21: Ribosomal protein L13 [52160] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) ![]() |
| Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein) |
| Protein Ribosomal protein L13 [52163] (5 species) synonym: 50S ribosomal protein L13p, HMAL13 |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [52164] (44 PDB entries) Uniprot P29198 |
| Domain d1vq9j1: 1vq9 J:4-145 [120226] Other proteins in same PDB: d1vq911, d1vq921, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9g1, d1vq9h1, d1vq9i1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1 automatically matched to d1ffkg_ complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3 |
PDB Entry: 1vq9 (more details), 2.4 Å
SCOP Domain Sequences for d1vq9j1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq9j1 c.21.1.1 (J:4-145) Ribosomal protein L13 {Archaeon Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw
Timeline for d1vq9j1:
View in 3DDomains from other chains: (mouse over for more information) d1vq911, d1vq921, d1vq931, d1vq9a1, d1vq9a2, d1vq9b1, d1vq9c1, d1vq9d1, d1vq9e1, d1vq9e2, d1vq9f1, d1vq9g1, d1vq9h1, d1vq9i1, d1vq9k1, d1vq9l1, d1vq9m1, d1vq9n1, d1vq9o1, d1vq9p1, d1vq9q1, d1vq9r1, d1vq9s1, d1vq9t1, d1vq9u1, d1vq9v1, d1vq9w1, d1vq9x1, d1vq9y1, d1vq9z1 |