Lineage for d1vq8y1 (1vq8 Y:95-236)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823885Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 823930Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family) (S)
  5. 823931Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
    contains irregular N-terminal extension to the common fold
  6. 823932Protein Ribosomal protein L32e [52044] (1 species)
  7. 823933Species Archaeon Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
    Uniprot P12736
  8. 823936Domain d1vq8y1: 1vq8 Y:95-236 [120212]
    Other proteins in same PDB: d1vq811, d1vq821, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8g1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8k1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8w1, d1vq8x1, d1vq8z1
    automatically matched to d1jj2x_
    complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3

Details for d1vq8y1

PDB Entry: 1vq8 (more details), 2.2 Å

PDB Description: the structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (Y:) 50S ribosomal protein L32e

SCOP Domain Sequences for d1vq8y1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq8y1 c.9.2.1 (Y:95-236) Ribosomal protein L32e {Archaeon Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

SCOP Domain Coordinates for d1vq8y1:

Click to download the PDB-style file with coordinates for d1vq8y1.
(The format of our PDB-style files is described here.)

Timeline for d1vq8y1: