SCOP 1.73: Domain d1vq8x1: 1vq8 X:7-88

Lineage for d1vq8x1 (1vq8 X:7-88)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.29: Ribosomal protein L31e [54574] (1 superfamily)
   beta-alpha-beta-(alpha)-beta(2); 2 layers: alpha/beta; mixed beta-sheet, order: 1342

4. Superfamily d.29.1: Ribosomal protein L31e [54575] (1 family)

5. Family d.29.1.1: Ribosomal protein L31e [54576] (1 protein)

6. Protein Ribosomal protein L31e [54577] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [54578] (40 PDB entries)

8. Domain d1vq8x1: 1vq8 X:7-88 [120211]
   Other proteins in same PDB: d1vq811, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8k1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8w1, d1vq8y1, d1vq8z1
   automatically matched to d1ffku_
   complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3

Details for d1vq8x1

PDB Entry: 1vq8, 2.2 Å

PDB Description: the structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (X:) 50S ribosomal protein L31e

SCOP Domain Sequences for d1vq8x1:

Sequence; same for both SEQRES and ATOM records:

>d1vq8x1 d.29.1.1 (X:7-88) Ribosomal protein L31e {Archaeon Haloarcula marismortui [TaxId: 2238]}
ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
pskirvraarfeeegeaiveae

Timeline for d1vq8x1:

• d1vq8x1 is new in SCOP 1.73
  
• d1vq8x1 appears in SCOP 1.75
  
• d1vq8x1 appears in the current release, SCOPe 2.08