| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily) core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold |
Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) ![]() |
| Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins) |
| Protein Archaeal L30 (L30a) [55133] (1 species) long-chain member of the family; contains additional C-terminal (sub)domain |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [55134] (40 PDB entries) Uniprot P14121 |
| Domain d1vq8w1: 1vq8 W:1-154 [120210] Other proteins in same PDB: d1vq811, d1vq821, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8g1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8k1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8x1, d1vq8y1, d1vq8z1 automatically matched to d1ffkt_ complexed with 1ma, aca, cd, cl, k, mg, na, omg, omu, psu, sps, sr, ur3 |
PDB Entry: 1vq8 (more details), 2.2 Å
SCOP Domain Sequences for d1vq8w1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq8w1 d.59.1.1 (W:1-154) Archaeal L30 (L30a) {Archaeon Haloarcula marismortui [TaxId: 2238]}
mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
prgghdgvkhpvkeggqlgkhdtegiddlleamr
Timeline for d1vq8w1:
View in 3DDomains from other chains: (mouse over for more information) d1vq811, d1vq821, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8g1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8k1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8r1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8x1, d1vq8y1, d1vq8z1 |