Lineage for d1vq8r1 (1vq8 R:1-150)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2948717Fold d.55: Ribosomal protein L22 [54842] (1 superfamily)
    beta-alpha(3)-beta(2); 2 layers: alpha/beta; related to the enolase/MLE N-domain fold by a circular permutation
  4. 2948718Superfamily d.55.1: Ribosomal protein L22 [54843] (1 family) (S)
    some topological similarity to prokaryotic ribosomal protein L17
  5. 2948719Family d.55.1.1: Ribosomal protein L22 [54844] (1 protein)
  6. 2948720Protein Ribosomal protein L22 [54845] (5 species)
  7. 2948758Species Haloarcula marismortui [TaxId:2238] [54847] (58 PDB entries)
    Uniprot P10970
  8. 2948759Domain d1vq8r1: 1vq8 R:1-150 [120205]
    Other proteins in same PDB: d1vq811, d1vq821, d1vq831, d1vq8a1, d1vq8a2, d1vq8b1, d1vq8c1, d1vq8d1, d1vq8e1, d1vq8e2, d1vq8f1, d1vq8g1, d1vq8h1, d1vq8i1, d1vq8j1, d1vq8k1, d1vq8l1, d1vq8m1, d1vq8n1, d1vq8o1, d1vq8p1, d1vq8q1, d1vq8s1, d1vq8t1, d1vq8u1, d1vq8v1, d1vq8w1, d1vq8x1, d1vq8y1, d1vq8z1
    automatically matched to d1ffko_
    protein/RNA complex; complexed with cd, cl, k, mg, na, sps, sr

Details for d1vq8r1

PDB Entry: 1vq8 (more details), 2.2 Å

PDB Description: the structure of ccda-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (R:) 50S ribosomal protein L22P

SCOPe Domain Sequences for d1vq8r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq8r1 d.55.1.1 (R:1-150) Ribosomal protein L22 {Haloarcula marismortui [TaxId: 2238]}
gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
eqqgrkpramgrasawnspqvdvelileep

SCOPe Domain Coordinates for d1vq8r1:

Click to download the PDB-style file with coordinates for d1vq8r1.
(The format of our PDB-style files is described here.)

Timeline for d1vq8r1: