| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) ![]() |
| Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
| Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
| Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries) Uniprot P14122 67-136 |
| Domain d1vq7i1: 1vq7 I:71-140 [120167] Other proteins in same PDB: d1vq711, d1vq721, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7g1, d1vq7h1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1 automatically matched to d1s72i_ protein/RNA complex; complexed with cd, cl, k, mg, na |
PDB Entry: 1vq7 (more details), 2.5 Å
SCOPe Domain Sequences for d1vq7i1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq7i1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tctslgvtie
Timeline for d1vq7i1:
View in 3DDomains from other chains: (mouse over for more information) d1vq711, d1vq721, d1vq731, d1vq7a1, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7g1, d1vq7h1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1 |