| Class b: All beta proteins [48724] (165 folds) |
| Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins) barrel, closed; n=5, S=8 |
| Protein N-terminal domain of ribosomal protein L2 [50299] (2 species) incomplete OB-fold lacking the last strand |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries) includes the N-terminal tail |
| Domain d1vq7a2: 1vq7 A:1-90 [120159] Other proteins in same PDB: d1vq711, d1vq731, d1vq7a1, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1 automatically matched to d1s72a2 complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, pae, psu, ur3 |
PDB Entry: 1vq7 (more details), 2.5 Å
SCOP Domain Sequences for d1vq7a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq7a2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Archaeon Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvsaeiap
Timeline for d1vq7a2:
View in 3DDomains from other chains: (mouse over for more information) d1vq711, d1vq731, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1 |