SCOPe 2.06: Domain d1vq7a1: 1vq7 A:91-237

Lineage for d1vq7a1 (1vq7 A:91-237)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.3: C-terminal domain of ribosomal protein L2 [50114] (1 protein)

6. Protein C-terminal domain of ribosomal protein L2 [50115] (5 species)

7. Species Haloarcula marismortui [TaxId:2238] [50117] (40 PDB entries)
   Uniprot P20276

8. Domain d1vq7a1: 1vq7 A:91-237 [120158]
   Other proteins in same PDB: d1vq711, d1vq721, d1vq731, d1vq7a2, d1vq7b1, d1vq7c1, d1vq7d1, d1vq7e1, d1vq7e2, d1vq7f1, d1vq7g1, d1vq7h1, d1vq7i1, d1vq7j1, d1vq7k1, d1vq7l1, d1vq7m1, d1vq7n1, d1vq7o1, d1vq7p1, d1vq7q1, d1vq7r1, d1vq7s1, d1vq7t1, d1vq7u1, d1vq7v1, d1vq7w1, d1vq7x1, d1vq7y1, d1vq7z1
   automatically matched to d1s72a1
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq7a1

PDB Entry: 1vq7, 2.5 Å

PDB Description: the structure of the transition state analogue "dca" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (A:) 50S ribosomal protein L2P

SCOPe Domain Sequences for d1vq7a1:

Sequence; same for both SEQRES and ATOM records:

>d1vq7a1 b.34.5.3 (A:91-237) C-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
gntlplaeipegvpvcnvesspgdggkfarasgvnaqllthdrnvavvklpsgemkrldp
qcratigvvagggrtdkpfvkagnkhhkmkargtkwpnvrgvamnavdhpfggggrqhpg
kpksisrnappgrkvgdiaskrtgrgg

Timeline for d1vq7a1:

• d1vq7a1 first appeared in SCOP 1.73
  
• d1vq7a1 appears in SCOPe 2.05
  
• d1vq7a1 appears in SCOPe 2.07
  
• d1vq7a1 appears in the current release, SCOPe 2.08