Lineage for d1vq6v1 (1vq6 V:1-65)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 904111Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 904128Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 904129Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 904130Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 904171Species Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)
    Uniprot P10971
  8. 904188Domain d1vq6v1: 1vq6 V:1-65 [120151]
    Other proteins in same PDB: d1vq611, d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1
    automatically matched to d1ffks_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq6v1

PDB Entry: 1vq6 (more details), 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOPe Domain Sequences for d1vq6v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq6v1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOPe Domain Coordinates for d1vq6v1:

Click to download the PDB-style file with coordinates for d1vq6v1.
(The format of our PDB-style files is described here.)

Timeline for d1vq6v1: