SCOP 1.75: Domain d1vq6u1: 1vq6 U:4-56

Lineage for d1vq6u1 (1vq6 U:4-56)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (18 families)

5. Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)

6. Protein Ribosomal protein L24e [57750] (1 species)

7. Species Archaeon Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
   Uniprot P14116

8. Domain d1vq6u1: 1vq6 U:4-56 [120150]
   Other proteins in same PDB: d1vq611, d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6g1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1
   automatically matched to d1ffkr_
   complexed with 1ma, 5aa, aca, btn, cd, cl, hfa, k, mg, na, omg, omu, psu, ur3

Details for d1vq6u1

PDB Entry: 1vq6, 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (U:) 50S ribosomal protein L24e

SCOP Domain Sequences for d1vq6u1:

Sequence; same for both SEQRES and ATOM records:

>d1vq6u1 g.39.1.6 (U:4-56) Ribosomal protein L24e {Archaeon Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Timeline for d1vq6u1:

• d1vq6u1 first appeared in SCOP 1.73
  
• d1vq6u1 appears in SCOPe 2.01
  
• d1vq6u1 appears in the current release, SCOPe 2.08