![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily) multihelical; consists of two different 3-helical domains connected by a long, partly helical linker |
![]() | Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) ![]() |
![]() | Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein) |
![]() | Protein Ribosomal protein L19 (L19e) [48142] (1 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [48143] (40 PDB entries) |
![]() | Domain d1vq6p1: 1vq6 P:1-143 [120145] Other proteins in same PDB: d1vq611, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1 automatically matched to d1s72p_ complexed with 1ma, 5aa, aca, btn, cd, cl, hfa, k, mg, na, omg, omu, psu, ur3 |
PDB Entry: 1vq6 (more details), 2.7 Å
SCOP Domain Sequences for d1vq6p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq6p1 a.94.1.1 (P:1-143) Ribosomal protein L19 (L19e) {Archaeon Haloarcula marismortui [TaxId: 2238]} tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr dlydkagggefdsvadleryida
Timeline for d1vq6p1:
![]() Domains from other chains: (mouse over for more information) d1vq611, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1 |