Lineage for d1vq6f1 (1vq6 F:1-119)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566728Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 2566729Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)
  6. 2566746Protein Ribosomal protein L7ae [55319] (7 species)
  7. 2566754Species Haloarcula marismortui [TaxId:2238] [55320] (58 PDB entries)
    Uniprot P12743
  8. 2566770Domain d1vq6f1: 1vq6 F:1-119 [120136]
    Other proteins in same PDB: d1vq611, d1vq621, d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6g1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1
    automatically matched to d1s72f_
    protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq6f1

PDB Entry: 1vq6 (more details), 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (F:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d1vq6f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq6f1 d.79.3.1 (F:1-119) Ribosomal protein L7ae {Haloarcula marismortui [TaxId: 2238]}
pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr

SCOPe Domain Coordinates for d1vq6f1:

Click to download the PDB-style file with coordinates for d1vq6f1.
(The format of our PDB-style files is described here.)

Timeline for d1vq6f1: