Lineage for d1vq611 (1vq6 1:1-56)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 750692Fold g.41: Rubredoxin-like [57769] (16 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 751110Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) (S)
  5. 751154Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein)
  6. 751155Protein Ribosomal protein L37e [57834] (1 species)
  7. 751156Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries)
  8. 751187Domain d1vq611: 1vq6 1:1-56 [120127]
    Other proteins in same PDB: d1vq631, d1vq6a1, d1vq6a2, d1vq6b1, d1vq6c1, d1vq6d1, d1vq6e1, d1vq6e2, d1vq6f1, d1vq6h1, d1vq6i1, d1vq6j1, d1vq6k1, d1vq6l1, d1vq6m1, d1vq6n1, d1vq6o1, d1vq6p1, d1vq6q1, d1vq6r1, d1vq6s1, d1vq6t1, d1vq6u1, d1vq6v1, d1vq6w1, d1vq6x1, d1vq6y1, d1vq6z1
    automatically matched to d1ffkx_
    complexed with 1ma, 5aa, aca, btn, cd, cl, hfa, k, mg, na, omg, omu, psu, ur3

Details for d1vq611

PDB Entry: 1vq6 (more details), 2.7 Å

PDB Description: the structure of c-hpmn and cca-phe-cap-bio bound to the large ribosomal subunit of haloarcula marismortui
PDB Compounds: (1:) 50S ribosomal protein L37e

SCOP Domain Sequences for d1vq611:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq611 g.41.8.2 (1:1-56) Ribosomal protein L37e {Archaeon Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage

SCOP Domain Coordinates for d1vq611:

Click to download the PDB-style file with coordinates for d1vq611.
(The format of our PDB-style files is described here.)

Timeline for d1vq611: