SCOPe 2.06: Domain d1vq5i1: 1vq5 I:71-140

Lineage for d1vq5i1 (1vq5 I:71-140)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family)

5. Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)

6. Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)

7. Species Haloarcula marismortui [TaxId:2238] [109705] (39 PDB entries)
   Uniprot P14122 67-136

8. Domain d1vq5i1: 1vq5 I:71-140 [120109]
   Other proteins in same PDB: d1vq511, d1vq521, d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5g1, d1vq5h1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1
   automatically matched to d1s72i_
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq5i1

PDB Entry: 1vq5, 2.6 Å

PDB Description: The structure of the transition state analogue "RAA" bound to the large ribosomal subunit of haloarcula marismortui

PDB Compounds: (I:) 50S ribosomal protein L11P

SCOPe Domain Sequences for d1vq5i1:

Sequence; same for both SEQRES and ATOM records:

>d1vq5i1 a.4.7.1 (I:71-140) Ribosomal protein L11, C-terminal domain {Haloarcula marismortui [TaxId: 2238]}
gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
tctslgvtie

Timeline for d1vq5i1:

• d1vq5i1 first appeared in SCOP 1.73
  
• d1vq5i1 appears in SCOPe 2.05
  
• d1vq5i1 appears in SCOPe 2.07
  
• d1vq5i1 appears in the current release, SCOPe 2.08