| Class g: Small proteins [56992] (85 folds) |
| Fold g.41: Rubredoxin-like [57769] (16 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (6 families) ![]() |
| Family g.41.8.2: Ribosomal protein L37e [57833] (1 protein) |
| Protein Ribosomal protein L37e [57834] (1 species) |
| Species Archaeon Haloarcula marismortui [TaxId:2238] [57835] (40 PDB entries) |
| Domain d1vq511: 1vq5 1:1-56 [120098] Other proteins in same PDB: d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5h1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1 automatically matched to d1ffkx_ complexed with 1ma, 2op, 5aa, cd, cl, dcz, k, mg, na, omg, omu, po2, psu, ur3 |
PDB Entry: 1vq5 (more details), 2.6 Å
SCOP Domain Sequences for d1vq511:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq511 g.41.8.2 (1:1-56) Ribosomal protein L37e {Archaeon Haloarcula marismortui [TaxId: 2238]}
tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
Timeline for d1vq511:
View in 3DDomains from other chains: (mouse over for more information) d1vq531, d1vq5a1, d1vq5a2, d1vq5b1, d1vq5c1, d1vq5d1, d1vq5e1, d1vq5e2, d1vq5f1, d1vq5h1, d1vq5i1, d1vq5j1, d1vq5k1, d1vq5l1, d1vq5m1, d1vq5n1, d1vq5o1, d1vq5p1, d1vq5q1, d1vq5r1, d1vq5s1, d1vq5t1, d1vq5u1, d1vq5v1, d1vq5w1, d1vq5x1, d1vq5y1, d1vq5z1 |