![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) ![]() |
![]() | Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein) |
![]() | Protein Ribosomal protein L29 (L29p) [46563] (5 species) |
![]() | Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries) Uniprot P10971 |
![]() | Domain d1vq4v1: 1vq4 V:1-65 [120093] Other proteins in same PDB: d1vq411, d1vq421, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4f1, d1vq4g1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1 automatically matched to d1ffks_ complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, po2, psu, ur3 |
PDB Entry: 1vq4 (more details), 2.7 Å
SCOP Domain Sequences for d1vq4v1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vq4v1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]} tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq geegd
Timeline for d1vq4v1:
![]() Domains from other chains: (mouse over for more information) d1vq411, d1vq421, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4f1, d1vq4g1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1 |