Lineage for d1vq4v1 (1vq4 V:1-65)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760101Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
  5. 760102Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 760103Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 760104Species Archaeon Haloarcula marismortui [TaxId:2238] [46564] (44 PDB entries)
    Uniprot P10971
  8. 760118Domain d1vq4v1: 1vq4 V:1-65 [120093]
    Other proteins in same PDB: d1vq411, d1vq421, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4f1, d1vq4g1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1
    automatically matched to d1ffks_
    complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq4v1

PDB Entry: 1vq4 (more details), 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui
PDB Compounds: (V:) 50S ribosomal protein L29P

SCOP Domain Sequences for d1vq4v1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq4v1 a.2.2.1 (V:1-65) Ribosomal protein L29 (L29p) {Archaeon Haloarcula marismortui [TaxId: 2238]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

SCOP Domain Coordinates for d1vq4v1:

Click to download the PDB-style file with coordinates for d1vq4v1.
(The format of our PDB-style files is described here.)

Timeline for d1vq4v1: