Lineage for d1vq4o1 (1vq4 O:1-115)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 824197Fold c.12: Ribosomal proteins L15p and L18e [52079] (1 superfamily)
    core: three turns of irregular (beta-beta-alpha)n superhelix
  4. 824198Superfamily c.12.1: Ribosomal proteins L15p and L18e [52080] (1 family) (S)
  5. 824199Family c.12.1.1: Ribosomal proteins L15p and L18e [52081] (2 proteins)
  6. 824291Protein Ribosomal protein L18e [52084] (1 species)
  7. 824292Species Archaeon Haloarcula marismortui [TaxId:2238] [52085] (40 PDB entries)
    Uniprot P12733
  8. 824306Domain d1vq4o1: 1vq4 O:1-115 [120086]
    Other proteins in same PDB: d1vq411, d1vq421, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4f1, d1vq4g1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4m1, d1vq4n1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1
    automatically matched to d1ffkl_
    complexed with 1ma, 2op, 5aa, cd, cl, k, mg, na, omg, omu, po2, psu, ur3

Details for d1vq4o1

PDB Entry: 1vq4 (more details), 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui
PDB Compounds: (O:) 50S ribosomal protein L18e

SCOP Domain Sequences for d1vq4o1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vq4o1 c.12.1.1 (O:1-115) Ribosomal protein L18e {Archaeon Haloarcula marismortui [TaxId: 2238]}
sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir

SCOP Domain Coordinates for d1vq4o1:

Click to download the PDB-style file with coordinates for d1vq4o1.
(The format of our PDB-style files is described here.)

Timeline for d1vq4o1: