SCOPe 2.05: Domain d1vq4m1: 1vq4 M:1-194

Lineage for d1vq4m1 (1vq4 M:1-194)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
   beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243

4. Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families)

5. Family d.12.1.2: L15e [54193] (1 protein)
   elaborated with additional structures
   automatically mapped to Pfam PF00827

6. Protein Ribosomal protein L15e [54194] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [54195] (42 PDB entries)
   Uniprot P60618

8. Domain d1vq4m1: 1vq4 M:1-194 [120084]
   Other proteins in same PDB: d1vq411, d1vq421, d1vq431, d1vq4a1, d1vq4a2, d1vq4b1, d1vq4c1, d1vq4d1, d1vq4e1, d1vq4e2, d1vq4f1, d1vq4g1, d1vq4h1, d1vq4i1, d1vq4j1, d1vq4k1, d1vq4l1, d1vq4n1, d1vq4o1, d1vq4p1, d1vq4q1, d1vq4r1, d1vq4s1, d1vq4t1, d1vq4u1, d1vq4v1, d1vq4w1, d1vq4x1, d1vq4y1, d1vq4z1
   automatically matched to d1s72m_
   protein/RNA complex; complexed with cd, cl, k, mg, na

Details for d1vq4m1

PDB Entry: 1vq4, 2.7 Å

PDB Description: The structure of the transition state analogue "DAA" bound to the large ribosomal subunit of Haloarcula marismortui

PDB Compounds: (M:) 50S ribosomal protein L15e

SCOPe Domain Sequences for d1vq4m1:

Sequence; same for both SEQRES and ATOM records:

>d1vq4m1 d.12.1.2 (M:1-194) Ribosomal protein L15e {Haloarcula marismortui [TaxId: 2238]}
arsaysyirdawenpgdgqlaelqwqrqqewrnegaverierptrldkarsqgykakqgv
ivarvsvrkgsarkrrhkagrrskrqgvtritrrkdiqrvaeerasrtfpnlrvlnsysv
gqdgrqkwhevilidpnhpaiqndddlswicaddqadrvfrgltgagrrnrglsgkgkgs
ektrpslrsnggka

Timeline for d1vq4m1:

• d1vq4m1 first appeared in SCOP 1.73
  
• d1vq4m1 appears in SCOPe 2.04
  
• d1vq4m1 appears in SCOPe 2.06
  
• d1vq4m1 appears in the current release, SCOPe 2.08