Lineage for d1vfub3 (1vfu B:121-502)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1339265Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1339266Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1339620Protein Maltogenic amylase, central domain [51465] (4 species)
    contains an additional N-terminal domain
  7. 1339635Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (16 PDB entries)
  8. 1339663Domain d1vfub3: 1vfu B:121-502 [120060]
    Other proteins in same PDB: d1vfua1, d1vfua2, d1vfub1, d1vfub2
    automatically matched to d1bvza3
    complexed with ca

Details for d1vfub3

PDB Entry: 1vfu (more details), 3.1 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 amylase 2/gamma- cyclodextrin complex
PDB Compounds: (B:) Neopullulanase 2

SCOPe Domain Sequences for d1vfub3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfub3 c.1.8.1 (B:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
nterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

SCOPe Domain Coordinates for d1vfub3:

Click to download the PDB-style file with coordinates for d1vfub3.
(The format of our PDB-style files is described here.)

Timeline for d1vfub3: