Lineage for d1vfua1 (1vfu A:1-120)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 658571Superfamily b.1.18: E set domains [81296] (20 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 658673Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (19 proteins)
    domains of unknown function associated with different type of catalytic domains in a different sequential location
    subgroup of the larger IPT/TIG domain family
  6. 658832Protein Maltogenic amylase, N-terminal domain N [49221] (4 species)
    precedes the catalytic (beta/alpha)8-barrel domain
  7. 658847Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [49223] (16 PDB entries)
  8. 658874Domain d1vfua1: 1vfu A:1-120 [120055]
    Other proteins in same PDB: d1vfua2, d1vfua3, d1vfub2, d1vfub3
    automatically matched to d1bvza1
    complexed with ca, glc; mutant

Details for d1vfua1

PDB Entry: 1vfu (more details), 3.1 Å

PDB Description: Crystal structure of Thermoactinomyces vulgaris R-47 amylase 2/gamma-cyclodextrin complex
PDB Compounds: (A:) Neopullulanase 2

SCOP Domain Sequences for d1vfua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfua1 b.1.18.2 (A:1-120) Maltogenic amylase, N-terminal domain N {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

SCOP Domain Coordinates for d1vfua1:

Click to download the PDB-style file with coordinates for d1vfua1.
(The format of our PDB-style files is described here.)

Timeline for d1vfua1: