Lineage for d1vfob3 (1vfo B:121-502)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568602Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1568603Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1569091Protein automated matches [190099] (19 species)
    not a true protein
  7. Species Thermoactinomyces vulgaris [TaxId:2026] [254920] (6 PDB entries)
  8. 1569202Domain d1vfob3: 1vfo B:121-502 [120053]
    Other proteins in same PDB: d1vfoa1, d1vfoa2, d1vfob1, d1vfob2
    automated match to d1ji2a3
    complexed with ca

Details for d1vfob3

PDB Entry: 1vfo (more details), 2.81 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 2/beta-cyclodextrin complex
PDB Compounds: (B:) Neopullulanase 2

SCOPe Domain Sequences for d1vfob3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfob3 c.1.8.1 (B:121-502) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp
yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda
vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten
pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas
gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh
nterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn
rglfefykelirlrhrlasltr

SCOPe Domain Coordinates for d1vfob3:

Click to download the PDB-style file with coordinates for d1vfob3.
(The format of our PDB-style files is described here.)

Timeline for d1vfob3: