SCOPe 2.04: Domain d1vfob1: 1vfo B:1-120

Lineage for d1vfob1 (1vfo B:1-120)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.0: automated matches [191341] (1 protein)
   not a true family

6. Protein automated matches [190226] (39 species)
   not a true protein

7. Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (6 PDB entries)

8. Domain d1vfob1: 1vfo B:1-120 [120051]
   Other proteins in same PDB: d1vfoa2, d1vfoa3, d1vfob2, d1vfob3
   automated match to d1wzla1
   complexed with ca

Details for d1vfob1

PDB Entry: 1vfo, 2.81 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 2/beta-cyclodextrin complex

PDB Compounds: (B:) Neopullulanase 2

SCOPe Domain Sequences for d1vfob1:

Sequence; same for both SEQRES and ATOM records:

>d1vfob1 b.1.18.0 (B:1-120) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
mlleaifheakgsyaypisetqlrvrlrakkgdvvrcevlyadryaspeeelahalagka
gsderfdyfeallecstkrvkyvflltgpqgeavyfgetgfsaerskagvfqyayihrse

Timeline for d1vfob1:

• d1vfob1 first appeared in SCOP 1.73
  
• d1vfob1 appears in SCOPe 2.03
  
• d1vfob1 appears in SCOPe 2.05
  
• d1vfob1 appears in the current release, SCOPe 2.08