Lineage for d1vfoa2 (1vfo A:503-585)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1555652Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1555653Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1556225Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 1556226Protein automated matches [226835] (27 species)
    not a true protein
  7. Species Thermoactinomyces vulgaris [TaxId:2026] [254921] (6 PDB entries)
  8. 1556347Domain d1vfoa2: 1vfo A:503-585 [120049]
    Other proteins in same PDB: d1vfoa1, d1vfoa3, d1vfob1, d1vfob3
    automated match to d1wzla2
    complexed with ca

Details for d1vfoa2

PDB Entry: 1vfo (more details), 2.81 Å

PDB Description: crystal structure of thermoactinomyces vulgaris r-47 alpha-amylase 2/beta-cyclodextrin complex
PDB Compounds: (A:) Neopullulanase 2

SCOPe Domain Sequences for d1vfoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vfoa2 b.71.1.0 (A:503-585) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

SCOPe Domain Coordinates for d1vfoa2:

Click to download the PDB-style file with coordinates for d1vfoa2.
(The format of our PDB-style files is described here.)

Timeline for d1vfoa2: