| Class b: All beta proteins [48724] (176 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
| Protein automated matches [226835] (27 species) not a true protein |
| Domain d1vfoa2: 1vfo A:503-585 [120049] Other proteins in same PDB: d1vfoa1, d1vfoa3, d1vfob1, d1vfob3 automated match to d1wzla2 complexed with ca |
PDB Entry: 1vfo (more details), 2.81 Å
SCOPe Domain Sequences for d1vfoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vfoa2 b.71.1.0 (A:503-585) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr
Timeline for d1vfoa2: