![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Maltogenic amylase, central domain [51465] (4 species) contains an additional N-terminal domain |
![]() | Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51467] (16 PDB entries) |
![]() | Domain d1vfma3: 1vfm A:121-502 [120044] Other proteins in same PDB: d1vfma1, d1vfma2, d1vfmb1, d1vfmb2 automatically matched to d1bvza3 complexed with bgc, ca, glc; mutant |
PDB Entry: 1vfm (more details), 2.9 Å
SCOP Domain Sequences for d1vfma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vfma3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} vfttpewakeaviyqifperfangdpsndppgteqwakdarprhdsfyggdlkgvidrlp yleelgvtalyftpifaspshhkydtadylaidpqfgdlptfrrlvdeahrrgikiilda vfnhagdqffafrdvlqkgeqsrykdwffiedfpvsktsrtnyetfavqvpampklrten pevkeylfdvarfwmeqgidgwrlnvanevdhafwrefrrlvkslnpdalivgeiwhdas gwlmgdqfdsvmnylfresvirffatgeihaerfdaeltrarmlypeqaaqglwnlldsh nterfltscggneakfrlavlfqmtylgtpliyygdeigmagatdpdcrrpmiweekeqn rglfefykelirlrhrlasltr
Timeline for d1vfma3: