Lineage for d1vepa1 (1vep A:418-516)
- Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds) 
Fold b.3: Prealbumin-like [49451] (7 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.1: Starch-binding domain-like [49452] (3 families) 
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) 
Protein beta-amylase [49462] (1 species) Species Bacillus cereus [TaxId:1396] [49463] (15 PDB entries) 
Domain d1vepa1: 1vep A:418-516 [120027]
Other proteins in same PDB: d1vepa2
automatically matched to d1b90a1
complexed with ca, glc; mutant
Details for d1vepa1
PDB Entry: 1vep (more details), 2.06 Å
PDB Description: crystal structure analysis of triple (t47m/y164e/t328n)/maltose of bacillus cereus beta-amylase at ph 6.5
PDB Compounds: (A:) beta-amylaseSCOP Domain Sequences for d1vepa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vepa1 b.3.1.1 (A:418-516) beta-amylase {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw
SCOP Domain Coordinates for d1vepa1:
Click to download the PDB-style file with coordinates for d1vepa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1vepa1:
- d1vepa1 first appeared in SCOP 1.73
- d1vepa1 appears in SCOPe 2.01
- d1vepa1 appears in the current release, SCOPe 2.08
View in 3D
