SCOPe 2.05: Domain d1veoa2: 1veo A:1-417

Lineage for d1veoa2 (1veo A:1-417)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (22 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [254917] (3 PDB entries)

8. Domain d1veoa2: 1veo A:1-417 [120026]
   Other proteins in same PDB: d1veoa1
   automated match to d1vema2
   complexed with ca, glc

Details for d1veoa2

PDB Entry: 1veo, 2.12 Å

PDB Description: crystal structure analysis of y164f/maltose of bacillus cereus beta- amylase at ph 4.6

PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d1veoa2:

Sequence; same for both SEQRES and ATOM records:

>d1veoa2 c.1.8.1 (A:1-417) automated matches {Bacillus cereus [TaxId: 1396]}
avngkgmnpdykaylmaplkkipevtnwetfendlrwakqngfyaitvdfwwgdmekngd
qqfdfsyaqrfaqsvknagmkmipiisthqcggnvgddcnvpipswvwnqksddslyfks
etgtvnketlnplasdvirkeygelytafaaamkpykdviakiflsggpagelrypsytt
sdgtgypsrgkfqaytefakskfrlwvlnkygslnevnkawgtkliselailppsdgeqf
lmngylsmygkdylewyqgilenhtkligelahnafdttfqvpigakiagvhwqynnpti
phgaekpagyndyshlldafksakldvtftclemtdkgsypeysmpktlvqniatlanek
givlngenalsigneeeykrvaemafnynfagftllryqdvmynnslmgkfkdllgv

Timeline for d1veoa2:

• d1veoa2 first appeared in SCOP 1.73
  
• d1veoa2 appears in SCOPe 2.04
  
• d1veoa2 appears in SCOPe 2.06
  
• d1veoa2 appears in the current release, SCOPe 2.08