SCOPe 2.06: Domain d1veoa1: 1veo A:418-516

Lineage for d1veoa1 (1veo A:418-516)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.0: automated matches [254199] (1 protein)
   not a true family

6. Protein automated matches [254436] (4 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [254918] (3 PDB entries)

8. Domain d1veoa1: 1veo A:418-516 [120025]
   Other proteins in same PDB: d1veoa2
   automated match to d1vema1
   complexed with ca, glc

Details for d1veoa1

PDB Entry: 1veo, 2.12 Å

PDB Description: crystal structure analysis of y164f/maltose of bacillus cereus beta- amylase at ph 4.6

PDB Compounds: (A:) beta-amylase

SCOPe Domain Sequences for d1veoa1:

Sequence; same for both SEQRES and ATOM records:

>d1veoa1 b.3.1.0 (A:418-516) automated matches {Bacillus cereus [TaxId: 1396]}
tpvmqtivvknvpttigdtvyitgnraelgswdtkqypiqlyydshsndwrgnvvlpaer
niefkafikskdgtvkswqtiqqswnpvplkttshtssw

Timeline for d1veoa1:

• d1veoa1 first appeared in SCOP 1.73
  
• d1veoa1 appears in SCOPe 2.05
  
• d1veoa1 appears in SCOPe 2.07
  
• d1veoa1 appears in the current release, SCOPe 2.08