Lineage for d1veja1 (1vej A:8-68)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636335Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 636359Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 636360Family a.5.2.1: UBA domain [46935] (22 proteins)
  6. 636361Protein 4931431F19Rik [140343] (1 species)
    Riken cDNA clone 4931431f19
  7. 636362Species Mouse (Mus musculus) [TaxId:10090] [140344] (1 PDB entry)
  8. 636363Domain d1veja1: 1vej A:8-68 [120020]

Details for d1veja1

PDB Entry: 1vej (more details)

PDB Description: solution structure of rsgi ruh-016, a uba domain from mouse cdna
PDB Compounds: (A:) RIKEN cDNA 4931431F19

SCOP Domain Sequences for d1veja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]}
aracsqssqtalptslftegryqqeleelkalgfanrdanlqalvatdgdihaaiemllg
a

SCOP Domain Coordinates for d1veja1:

Click to download the PDB-style file with coordinates for d1veja1.
(The format of our PDB-style files is described here.)

Timeline for d1veja1: