Lineage for d1ve5c1 (1ve5 C:2-311)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708963Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 708964Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 708965Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)
  6. 709103Protein Threonine deaminase [53692] (2 species)
  7. 709106Species Thermus thermophilus [TaxId:274] [142747] (1 PDB entry)
  8. 709109Domain d1ve5c1: 1ve5 C:2-311 [120015]
    automatically matched to 1VE5 A:2-311
    complexed with ca, plp

Details for d1ve5c1

PDB Entry: 1ve5 (more details), 2.15 Å

PDB Description: Crystal Structure of T.th. HB8 Threonine deaminase
PDB Compounds: (C:) Threonine deaminase

SCOP Domain Sequences for d1ve5c1:

Sequence, based on SEQRES records: (download)

>d1ve5c1 c.79.1.1 (C:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]}
pslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskala
lenpkgllavssgnhaqgvayaaqvlgvkalvvmpedaspykkacaraygaevvdrgvta
knreevaralqeetgyalihpfddplviagqgtaglellaqagrmgvfpgavlapvgggg
llaglatavkalspttlvlgvepeaaddakrsleagrilrleapprtradgvrtlslger
tfpilrervdgiltvseealleaerllftrtkqvveptgalplaavlehgarlpqtlall
lsggnrdfsp

Sequence, based on observed residues (ATOM records): (download)

>d1ve5c1 c.79.1.1 (C:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]}
pslqdlyaafrriapythrtplltsrlldgllgkrlllkaehlqktgsfkargalskala
lenpkgllavssgnhaqgvayaaqvlgvkalvalqeetgyalihpfddplviagqgtagl
ellaqagrmgvfpgavlapvggggllaglatavkalspttlvlgvepeaaddakrsleag
rilrleapprtradgvrtlslgertfpilrervdgiltvseealleaerllftrtkqvve
ptgalplaavlehgarlpqtlalllsggnrdfsp

SCOP Domain Coordinates for d1ve5c1:

Click to download the PDB-style file with coordinates for d1ve5c1.
(The format of our PDB-style files is described here.)

Timeline for d1ve5c1: