Lineage for d1vbrb1 (1vbr B:517-840)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 681098Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 682152Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 682589Family c.1.8.3: beta-glycanases [51487] (24 proteins)
    consist of a number of sequence families
  6. 682957Protein Xylanase [51488] (6 species)
  7. 682976Species Thermotoga maritima [TaxId:2336] [141772] (2 PDB entries)
  8. 682980Domain d1vbrb1: 1vbr B:517-840 [119962]
    automatically matched to 1VBR A:517-840
    complexed with acy, xyp, xys

Details for d1vbrb1

PDB Entry: 1vbr (more details), 1.8 Å

PDB Description: crystal structure of complex xylanase 10b from thermotoga maritima with xylobiose
PDB Compounds: (B:) endo-1,4-beta-xylanase B

SCOP Domain Sequences for d1vbrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vbrb1 c.1.8.3 (B:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]}
vslrelaeklniyigfaainnfwslsdaekymevarrefniltpenqmkwdtihperdry
nftpaekhvefaeendmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvvshfk
grvkiwdvvneavsdsgtyresvwyktigpeyiekafrwakeadpdailiyndysieein
aksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyitemdv
riplsgseeyylkkqaevcakifdicldnpavkaiqfwgftdkyswvpgffkgygkallf
denynpkpcyyaikevlekkieer

SCOP Domain Coordinates for d1vbrb1:

Click to download the PDB-style file with coordinates for d1vbrb1.
(The format of our PDB-style files is described here.)

Timeline for d1vbrb1: