SCOPe 2.05: Domain d1vaha1: 1vah A:409-496

Lineage for d1vaha1 (1vah A:409-496)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (30 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [225876] (3 PDB entries)

8. Domain d1vaha1: 1vah A:409-496 [119905]
   Other proteins in same PDB: d1vaha2
   automated match to d1jxka1
   complexed with ca, cl, npo

Details for d1vaha1

PDB Entry: 1vah, 2.4 Å

PDB Description: crystal structure of the pig pancreatic-amylase complexed with r- nitrophenyl-a-d-maltoside

PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1vaha1:

Sequence; same for both SEQRES and ATOM records:

>d1vaha1 b.71.1.0 (A:409-496) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
wwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvy
vssdgtaqfsisnsaedpfiaihaeskl

Timeline for d1vaha1:

• d1vaha1 first appeared in SCOP 1.73
  
• d1vaha1 appears in SCOPe 2.04
  
• d1vaha1 appears in SCOPe 2.06
  
• d1vaha1 appears in the current release, SCOPe 2.08