Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (30 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [225876] (3 PDB entries) |
Domain d1vaha1: 1vah A:409-496 [119905] Other proteins in same PDB: d1vaha2 automated match to d1jxka1 complexed with ca, cl, npo |
PDB Entry: 1vah (more details), 2.4 Å
SCOPe Domain Sequences for d1vaha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vaha1 b.71.1.0 (A:409-496) automated matches {Pig (Sus scrofa) [TaxId: 9823]} wwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsctgikvy vssdgtaqfsisnsaedpfiaihaeskl
Timeline for d1vaha1: